NebiusForge
Model CatalogTrainingAgentsDocsStatusAccountSign in
← Back to catalog
Healthcare / Life Science·nvidia_nim·apache-2.0/cc-by-4.0·Added Apr 27, 2026

AlphaFold2

DeepMind AlphaFold2 NVIDIA NIM for protein structure prediction from amino acid sequence. This manifest remains onboarding-only until the pod-start failure observed on H200/eu-north2 is diagnosed and a successful Forge probe is recorded.

protein_sequence→structure, json
life-sciencebiologyproteinprotein-folding+2
Try in playground ↓Deploy Serverless ↓Open NVIDIA model card ↗API docs
Context window
4096
VRAM needed
33.8 GB

Observed working set on a supported GPU.

API route
POST /protein-structure/alphafold2/predict-structure-from-sequence

After the last request a backend stays warm on its GPU for about 15 minutes, then frees the GPU. The next request triggers a fresh cold start.

Status
cold
Not running.
API target

deepmind-alphafold2 version v1 using scheduler-selected GPU/region

POST to the native route with the shown model field; the playground below generates a full payload.

Open docsTry target
API route
/protein-structure/alphafold2/predict-structure-from-sequence
HTTP method
POST
Model field
deepmind-alphafold2
Version field
model_version: v1
  1. 1Verify targetRuns the auth guard and selected endpoint/model/routing check.
  2. 2Validate targetConfirm the selected GPU or region is still verified, or print copyable best-target exports.
  3. 3Estimate runValidate warm and first-cold request cost before prewarming or first traffic.
  4. 4Check runtimeConfirm whether the selected version is warm or starting.
  5. 5Prewarm targetStart the selected version on its pinned GPU or region before latency-sensitive traffic.
  6. 6Open docsUse the selected target snippets for the first request.Open docs
One-block API check

Terminal-ready smoke test for this selected target.

View command
set -euo pipefail
# Forge API smoke test
# Forge selected target: route=/v1/models/deepmind-alphafold2/inference-routes model=deepmind-alphafold2 version=v1
FORGE_API_BASE=${FORGE_API_BASE:-'https://YOUR_FORGE_HOST'}
case "${FORGE_API_KEY:-}" in
  ""|replace-with-your-forge-api-key)
    echo 'Set FORGE_API_KEY to a real Forge API key before running this snippet; browser SSO sessions are not sent to copied curl or SDK clients.' >&2
    exit 1
    ;;
esac
forge_api_url() {
  endpoint="$1"
  base="${FORGE_API_BASE%/}"
  case "$base:$endpoint" in
    */v1:/v1|*/v1:/v1/*|*/v1:/v1\?*) printf '%s%s\n' "$base" "${endpoint#/v1}" ;;
    *) printf '%s%s\n' "$base" "$endpoint" ;;
  esac
}
curl -sS --fail-with-body "$(forge_api_url '/v1/models/deepmind-alphafold2/inference-routes?model_version=v1')" \
  --max-time "${FORGE_REQUEST_TIMEOUT_SECONDS:-600}" \
  -H "Authorization: Bearer ${FORGE_API_KEY}" | \
python3 -m json.tool
Client fit

Native route check · Best for model-specific payloads; run the route check first, then copy the schema-specific request from the playground.

Routing auto-selected

Copied snippets omit gpu_type and region, so Forge chooses a compatible GPU and region at request time. Use GPU performance to pin a target.

Request URL
https://YOUR_FORGE_HOST/protein-structure/alphafold2/predict-structure-from-sequence
Authentication

Client auth: Set FORGE_API_KEY to a real Forge API key before running copied curl, fetch, or SDK snippets. Browser SSO only authenticates this web session.

Open Account
Authorization: Bearer $FORGE_API_KEY
Pinned setup
export FORGE_API_BASE='https://YOUR_FORGE_HOST'
export FORGE_API_KEY="${FORGE_API_KEY:-replace-with-your-forge-api-key}"
export FORGE_REQUEST_TIMEOUT_SECONDS="${FORGE_REQUEST_TIMEOUT_SECONDS:-600}"
export FORGE_API_ROUTE='/protein-structure/alphafold2/predict-structure-from-sequence'
export MODEL_OR_FAMILY_SLUG='deepmind-alphafold2'
export FORGE_MODEL_VERSION='v1'
Project .env

Copy these values into a local .env file when moving the selected target into an app or SDK client.

# Forge selected target: route=/protein-structure/alphafold2/predict-structure-from-sequence model=deepmind-alphafold2 version=v1
FORGE_API_BASE="https://YOUR_FORGE_HOST"
FORGE_API_ROUTE="/protein-structure/alphafold2/predict-structure-from-sequence"
FORGE_API_KEY="replace-with-your-forge-api-key"
FORGE_REQUEST_TIMEOUT_SECONDS="600"
MODEL_OR_FAMILY_SLUG="deepmind-alphafold2"
FORGE_MODEL_VERSION="v1"
Project .gitignore

Add these rules before replacing the placeholder API key so local Forge secrets stay out of commits while .env.example can remain tracked.

# Forge local API secrets
.env
.env.*
!.env.example
Preflight URLs and commands
Run estimate URL
https://YOUR_FORGE_HOST/v1/models/deepmind-alphafold2/run-estimate?model_version=v1
Best verified target
set -euo pipefail # Forge selected target: route=/protein-structure/alphafold2/predict-structure-from-sequence model=deepmind-alphafold2 version=v1 FORGE_API_BASE=${FORGE_API_BASE:-'https://YOUR_FORGE_HOST'} export MODEL_OR_FAMILY_SLUG=${MODEL_OR_FAMILY_SLUG:-'deepmind-alphafold2'} export FORGE_MODEL_VERSION=${FORGE_MODEL_VERSION:-'v1'} case "${FORGE_API_KEY:-}" in ""|replace-with-your-forge-api-key) echo 'Set FORGE_API_KEY to a real Forge API key before running this snippet; browser SSO sessions are not sent to copied curl or SDK clients.' >&2 exit 1 ;; esac forge_api_url() { endpoint="$1" base="${FORGE_API_BASE%/}" case "$base:$endpoint" in */v1:/v1|*/v1:/v1/*|*/v1:/v1\?*) printf '%s%s\n' "$base" "${endpoint#/v1}" ;; *) printf '%s%s\n' "$base" "$endpoint" ;; esac } reliability_path="$(python3 -c 'import os from urllib.parse import quote, urlencode model = os.environ.get("MODEL_OR_FAMILY_SLUG", "").strip() if not model: raise SystemExit("Set MODEL_OR_FAMILY_SLUG from search or route finder output before checking reliability.") params = {} model_version = os.environ.get("FORGE_MODEL_VERSION", "").strip() if model_version: params["model_version"] = model_version gpu_type = os.environ.get("FORGE_GPU_TYPE", "").strip() if gpu_type: params["gpu_type"] = gpu_type region = os.environ.get("FORGE_REGION", "").strip() if region: params["region"] = region path = "/v1/models/" + quote(model, safe="") + "/reliability" if params: path += "?" + urlencode(params) print(path)')" curl -sS --fail-with-body "$(forge_api_url "$reliability_path")" \ --max-time "${FORGE_REQUEST_TIMEOUT_SECONDS:-600}" \ -H "Authorization: Bearer ${FORGE_API_KEY}" | \ python3 -c 'import json, shlex, sys payload = json.load(sys.stdin) print( f"{payload.get('\''slug'\'')} reliability={payload.get('\''reliability_status'\'')} " f"supported={payload.get('\''supported_rows'\'', 0)}/{payload.get('\''total_rows'\'', 0)}" ) filters = payload.get("filters") or {} if filters: print("filters: " + ", ".join(f"{key}={value}" for key, value in filters.items())) def describe_target(target): details = [] request_ms = target.get("request_ms_p50") or target.get("request_ms") if request_ms is not None: details.append(f"p50={request_ms}ms") warm_cost = target.get("estimated_warm_request_cost_usd") if warm_cost is not None: details.append(f"warm_cost_usd={warm_cost}") elif target.get("cost_per_gpu_hour_usd") is not None: details.append(f"gpu_hour_usd={target['\''cost_per_gpu_hour_usd'\'']}") success_rate = target.get("observed_success_rate") if isinstance(success_rate, (int, float)): details.append(f"success={success_rate:.0%}") return ", ".join(details) or target.get("status") or "supported" exports = {} for label, key in ( ("fastest supported", "fastest_supported_target"), ("lowest-cost supported", "lowest_cost_supported_target"), ): target = payload.get(key) or {} gpu_type = target.get("gpu_type") if not gpu_type: continue identity = (str(gpu_type), str(target.get("region") or "")) exports.setdefault(identity, {"labels": [], "target": target})["labels"].append(label) if not exports: print("No supported GPU/region target returned.", file=sys.stderr) print(json.dumps({ "status_counts": payload.get("status_counts", {}), "failure_reason_counts": payload.get("failure_reason_counts", {}), }, indent=2)) raise SystemExit(1) for (gpu_type, region), entry in exports.items(): assignments = [f"FORGE_GPU_TYPE={shlex.quote(gpu_type)}"] if region: assignments.append(f"FORGE_REGION={shlex.quote(region)}") labels = " + ".join(entry["labels"]) details = describe_target(entry["target"]) print(f"export {'\'' '\''.join(assignments)} # {labels}: {details}")'
Runtime status URL
https://YOUR_FORGE_HOST/v1/model-families/deepmind-alphafold2/status?version=v1
Runtime warmup command
set -euo pipefail # Forge selected target: route=/protein-structure/alphafold2/predict-structure-from-sequence model=deepmind-alphafold2 version=v1 FORGE_API_BASE=${FORGE_API_BASE:-'https://YOUR_FORGE_HOST'} export MODEL_OR_FAMILY_SLUG=${MODEL_OR_FAMILY_SLUG:-'deepmind-alphafold2'} export FORGE_MODEL_VERSION=${FORGE_MODEL_VERSION:-'v1'} export FORGE_KEEP_WARM=${FORGE_KEEP_WARM:-false} case "${FORGE_API_KEY:-}" in ""|replace-with-your-forge-api-key) echo 'Set FORGE_API_KEY to a real Forge API key before running this snippet; browser SSO sessions are not sent to copied curl or SDK clients.' >&2 exit 1 ;; esac forge_api_url() { endpoint="$1" base="${FORGE_API_BASE%/}" case "$base:$endpoint" in */v1:/v1|*/v1:/v1/*|*/v1:/v1\?*) printf '%s%s\n' "$base" "${endpoint#/v1}" ;; *) printf '%s%s\n' "$base" "$endpoint" ;; esac } runtime_start_path="$(python3 -c 'import os from urllib.parse import quote model = os.environ.get("MODEL_OR_FAMILY_SLUG", "").strip() if not model: raise SystemExit("Set MODEL_OR_FAMILY_SLUG from the model picker output") print("/v1/model-families/" + quote(model, safe="") + "/start")')" python3 -c 'import json, os def env_value(name): value = os.environ.get(name, "").strip() return value or None payload = {} version = env_value("FORGE_MODEL_VERSION") if version: payload["version"] = version gpu_type = env_value("FORGE_GPU_TYPE") if gpu_type: payload["gpu_type"] = gpu_type region = env_value("FORGE_REGION") if region: payload["region"] = region keep_warm = env_value("FORGE_KEEP_WARM") payload["run_until_stopped"] = (keep_warm or "").lower() in {"1", "true", "yes", "on"} print(json.dumps(payload))' | \ curl -sS --fail-with-body "$(forge_api_url "$runtime_start_path")" \ --max-time "${FORGE_REQUEST_TIMEOUT_SECONDS:-600}" \ -X POST \ -H "Authorization: Bearer ${FORGE_API_KEY}" \ -H "Content-Type: application/json" \ -d @- | \ python3 -c 'import json, sys payload = json.load(sys.stdin) slug = payload.get("slug") or "runtime" gpu_type = payload.get("gpu_type") or "scheduler-selected GPU" region = payload.get("region") or "scheduler-selected region" startup_ms = payload.get("startup_ms") state = "cold-started" if payload.get("was_cold_start") else "already warm" suffix = f"; startup_ms={startup_ms}" if startup_ms is not None else "" print(f"{slug} {state} on {gpu_type} in {region}{suffix}; keep_warm={payload.get('\''keep_warm'\'')}")'

GPU performance

Pick a verified target for repeatable runs. Failed or pending details appear on the status hover.

Try selected target
Runs on · v1
· floor 40 GB
Target readiness

No verified targets yet

0/6 verified1 awaiting probe5 unavailable
GPURegionStatusVRAMCold startModel timeRelativeEst. $/GPU-hr
B200us-central1incompatible134.4 GB———$7.15
B300uk-south1incompatible————$7.85
H100—not probed—————
H200eu-north2incompatible——7m 55sp50 warm model time
1 sample
100%$4.50
L40Seu-north1incompatible33.8 GB—9m 9slatest warm probe time87% · -13%$1.82
RTX6000us-central1incompatible71.8 GB———$1.80
How we measure

Model time uses the p50 warm model-reported execution time when available, then falls back to the latest probe time; p95/p99 and sample count appear when there is enough probe history. Cold start excludes the first (uncached) run. VRAM is the peak GPU memory seen during the probe. Relative compares each row's model time to the highlighted baseline (fastest row by default; hover any row to re-root). The fastest chip marks only verified supported GPU-region rows. Estimated on-demand GPU price (Nebius pay-as-you-go); shown for performance/price comparison. Configured minimum GPU memory: 40 GB.

Try it out

cold·Healthcare / Life Science
Open Account
Leave GPU on “Any available GPU” to use a warm or verified backend automatically.API docs for this target
Request targetRoute/protein-structure/alphafold2/predict-structure-from-sequenceModeldeepmind-alphafold2Versionv1GPUautomaticRegionautomatic

Inputs

API examples

Use the API

API docs

Snippet target: deepmind-alphafold2 version v1 using scheduler-selected GPU/region.

Client auth: Set FORGE_API_KEY to a real Forge API key before running copied curl, fetch, or SDK snippets. Browser SSO only authenticates this web session.

Open Account
FORGE_API_BASE=${FORGE_API_BASE:-'https://YOUR_FORGE_HOST'}
case "${FORGE_API_KEY:-}" in
  ""|replace-with-your-forge-api-key)
    echo 'Set FORGE_API_KEY to a real Forge API key before running this snippet; browser SSO sessions are not sent to copied curl or SDK clients.' >&2
    exit 1
    ;;
esac
forge_api_url() {
  endpoint="$1"
  base="${FORGE_API_BASE%/}"
  case "$base:$endpoint" in
    */v1:/v1|*/v1:/v1/*|*/v1:/v1\?*) printf '%s%s\n' "$base" "${endpoint#/v1}" ;;
    *) printf '%s%s\n' "$base" "$endpoint" ;;
  esac
}
forge_print_response() {
  response_file="$1"
  if [ ! -s "$response_file" ]; then
    printf '%s\n' '(empty response)'
    return 0
  fi
  if command -v python3 >/dev/null 2>&1; then
    python3 -m json.tool "$response_file" 2>/dev/null || cat "$response_file"
  else
    cat "$response_file"
  fi
}
response_file="$(mktemp)"
if curl -sS --fail-with-body "$(forge_api_url '/protein-structure/alphafold2/predict-structure-from-sequence')" \
  --max-time "${FORGE_REQUEST_TIMEOUT_SECONDS:-600}" \
  -H "Authorization: Bearer ${FORGE_API_KEY}" \
  -H "Content-Type: application/json" \
  -d '{
  "e_value": 1,
  "sequence": "MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF",
  "algorithm": "mmseqs2",
  "databases": [
    "uniref90",
    "mgnify",
    "small_bfd"
  ],
  "iterations": 1,
  "relax_prediction": false,
  "structure_model_preset": "monomer",
  "structure_models_to_relax": "none",
  "model": "deepmind-alphafold2",
  "model_version": "v1"
}' \
  -o "$response_file"; then
  forge_print_response "$response_file"
  status=$?
  rm -f "$response_file"
  (exit "$status")
else
  status=$?
  cat "$response_file" >&2
  rm -f "$response_file"
  (exit "$status")
fi
Setup & .env

Install for curl

Copy setup before the request when moving this snippet into a fresh shell. The default 600 second timeout is intentional for GPU cold starts and can be overridden with FORGE_REQUEST_TIMEOUT_SECONDS.

export FORGE_API_BASE='https://YOUR_FORGE_HOST'
export FORGE_API_KEY="${FORGE_API_KEY:-replace-with-your-forge-api-key}"
export FORGE_REQUEST_TIMEOUT_SECONDS="${FORGE_REQUEST_TIMEOUT_SECONDS:-600}"

Project .env

Copy these values into a local .env file when moving the selected target into an app or SDK client.

# Forge selected target: route=/protein-structure/alphafold2/predict-structure-from-sequence model=deepmind-alphafold2 version=v1
FORGE_API_BASE="https://YOUR_FORGE_HOST"
FORGE_API_ROUTE="/protein-structure/alphafold2/predict-structure-from-sequence"
FORGE_API_KEY="replace-with-your-forge-api-key"
FORGE_REQUEST_TIMEOUT_SECONDS="600"
MODEL_OR_FAMILY_SLUG="deepmind-alphafold2"
FORGE_MODEL_VERSION="v1"
Output

Run a request to see output here.

Deploy to Nebius Serverless

Run a dedicated, autoscaling endpoint in your own Nebius account. The endpoint runs under your account and billing — Forge just pre-fills the configuration for you.

Deploy in your Nebius account ↗

Opens the Nebius Console with the image pre-filled for AlphaFold2 (Forge version v1).

Prefer to create the endpoint from the CLI, or self-manage the container image? Use the commands below.

The image is hosted on cr.eu-north1.nebius.cloud; you may need registry credentials in the Console form. The CLI below includes placeholders.

The links use Forge’s eu-north1 Nebius Container Registry mirror. If your project can’t pull that private mirror, add pull credentials or a registry secret.

nebius CLI
# Runs in YOUR Nebius account (you own + pay for the endpoint).
# platform/preset must exist in your project — list them with:
#   nebius compute platform list
export ENDPOINT_NAME="deepmind-alphafold2-nim-private"
export AUTH_TOKEN=$(openssl rand -hex 32)
export SUBNET_ID=$(nebius vpc subnet list --format jsonpath='{.items[0].metadata.id}')
export REGISTRY_USERNAME="YOUR_REGISTRY_USERNAME"
export REGISTRY_PASSWORD="YOUR_REGISTRY_PASSWORD"

# Note: the --image above points at Forge's regional Nebius CR mirror.
#   Serverless AI can pull Container Registry images without credentials
#   only when the image is public or in the same project. For a private
#   mirror in another project, provide pull credentials or a MysteryBox
#   registry secret with REGISTRY_USERNAME and REGISTRY_PASSWORD.

nebius ai endpoint create \
  --name "$ENDPOINT_NAME" \
  --image "cr.eu-north1.nebius.cloud/e00h91c5sa606xfwpj/models/nim-deepmind-alphafold2:latest" \
  --registry-username "$REGISTRY_USERNAME" \
  --registry-password "$REGISTRY_PASSWORD" \
  --container-port 8000 \
  --auth token \
  --token "$AUTH_TOKEN" \
  --subnet-id "$SUBNET_ID"

export ENDPOINT_ID=$(nebius ai endpoint get-by-name --name "$ENDPOINT_NAME" --format jsonpath='{.metadata.id}')
nebius ai endpoint get "$ENDPOINT_ID"

Need a throughput- and cost-optimized build tuned for specific Nebius GPUs? Nebius Token Factory is coming soon — contact your Nebius account team for early access.